X
Email:
sales@ruixibiotech.com

Apelin-36,CAS :252642-12-9

Apelin-36

Catalog # Pkg Size Price(USD) Quantity Buy this product
R-M-1583 2.5mg 365.00
- +
+ Add to cart

Product description

Orphan G protein-coupled receptor shown to be a coreceptor for simian and human immunodeficiency virus (SIV and HIV) strains. As long as apelin is an endogenous ligand for the APJ receptor, inhibitory effects of apelin peptides on HIV infection have been found to display that apelin peptides inhibit the entry of some HIV-1 and HIV-2 strains into NP-2/CD4 cells expressing APJ. Strong inhibitory efficiency. 


Appearance N/A
Molecular weight N/A
Purity >90%
Solubility N/A
Cas 252642-12-9
Sequence H-Leu-Val-Gln-Pro-Arg-Gly-Ser-Arg-Asn-Gly-Pro-Gly-Pro-Trp-Gln-Gly-Gly-Arg-Arg-Lys-Phe-Arg-Arg-Gln-Arg-Pro-Arg-Leu-Ser-His-Lys-Gly-Pro-Met-Pro-Phe-OH (trifluoroacetate salt)/LVQPRGSRNGPGPWQGGRRKFRRQRPRLSHKGPMPF
Molecular Formula C184H297N69O43S1
SYNONYMS Apelin-36 (human)
Storage -20℃,protected from light and moisture
Transportation 4-25℃ temperature for up to 2 weeks
Stability 1 year
Document

Related Product