Apelin-36,CAS :252642-12-9
Apelin-36
Product description
Orphan G protein-coupled receptor shown to be a coreceptor for simian and human immunodeficiency virus (SIV and HIV) strains. As long as apelin is an endogenous ligand for the APJ receptor, inhibitory effects of apelin peptides on HIV infection have been found to display that apelin peptides inhibit the entry of some HIV-1 and HIV-2 strains into NP-2/CD4 cells expressing APJ. Strong inhibitory efficiency.
| Appearance | N/A |
|---|---|
| Molecular weight | N/A |
| Purity | >90% |
| Solubility | N/A |
| Cas | 252642-12-9 |
| Sequence | H-Leu-Val-Gln-Pro-Arg-Gly-Ser-Arg-Asn-Gly-Pro-Gly-Pro-Trp-Gln-Gly-Gly-Arg-Arg-Lys-Phe-Arg-Arg-Gln-Arg-Pro-Arg-Leu-Ser-His-Lys-Gly-Pro-Met-Pro-Phe-OH (trifluoroacetate salt)/LVQPRGSRNGPGPWQGGRRKFRRQRPRLSHKGPMPF |
| Molecular Formula | C184H297N69O43S1 |
| SYNONYMS | Apelin-36 (human) |
| Storage | -20℃,protected from light and moisture |
| Transportation | 4-25℃ temperature for up to 2 weeks |
| Stability | 1 year |
Document
Related Product

Items-$0.00

Email:
Tel.:
msds of Apelin-36
RuixiBiotechCo.Ltd /KamulinBiotechco.ltd
Add: Room 20F 2002, Meiyuan Building, Yanta District, Xi’ an City, Shaanxi Province 710061 China
Tel: 02988811435
Fax: (86-29)8881-1435
Email: sales@ruixibiotech.com
Web: http://www.ruixibiotech.com


